DIAPH-2 Recombinant Protein Antigen

Images

 
There are currently no images for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DIAPH-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DIAPH-2.

Source: E. coli

Amino Acid Sequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DIAPH2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-52966. Protein

was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DIAPH-2 Recombinant Protein Antigen

  • DIA2
  • DIAdiaphanous (Drosophila, homolog) 2
  • DIAPH2
  • DIAPH-2
  • diaphanous homolog 2 (Drosophila)
  • Diaphanous-related formin-2
  • diaphorase-2
  • DRF2
  • POF
  • POF2
  • POF2FLJ11167
  • protein diaphanous homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB600-230
Species: Hu
Applications: WB
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-02705
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP) (0)

There are no publications for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP) (0)

There are no reviews for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DIAPH-2 Products

DIAPH-2 NBP2-52966PEP

Bioinformatics Tool for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP)

Discover related pathways, diseases and genes to DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP)

Discover more about diseases related to DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP).
 

Pathways for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP)

View related products by pathway.

PTMs for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP)

Learn more about PTMs related to DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP).
 

Research Areas for DIAPH-2 Recombinant Protein Antigen (NBP2-52966PEP)

Find related products by research area.

Blogs on DIAPH-2

There are no specific blogs for DIAPH-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DIAPH-2 Antibody
NBP1-85217

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DIAPH-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DIAPH2
Entrez