DHX15 Antibody

Images

 
Western Blot: DHX15 Antibody [NBP2-13919] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DHX15 Antibody [NBP2-13919] - Staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSL PQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DHX15 Protein (NBP2-13919PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX15 Antibody

  • ATP-dependent RNA helicase #46
  • DBP1DEAH box protein 15
  • DDX15putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15
  • DEAH (Asp-Glu-Ala-His) box polypeptide 15
  • EC 3.6.1
  • EC 3.6.4.13
  • HRH2DEAD/H box-15
  • PRP43
  • PRPF43
  • PrPp43p
  • RNA helicase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
MAB4726
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91832
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
AF7637
Species: Hu
Applications: WB
NB100-56472
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NLS476
Species: Hu, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90086
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DHX15 Antibody (NBP2-13919) (0)

There are no publications for DHX15 Antibody (NBP2-13919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX15 Antibody (NBP2-13919) (0)

There are no reviews for DHX15 Antibody (NBP2-13919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DHX15 Antibody (NBP2-13919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX15 Products

Bioinformatics Tool for DHX15 Antibody (NBP2-13919)

Discover related pathways, diseases and genes to DHX15 Antibody (NBP2-13919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX15 Antibody (NBP2-13919)

Discover more about diseases related to DHX15 Antibody (NBP2-13919).
 

Pathways for DHX15 Antibody (NBP2-13919)

View related products by pathway.

Blogs on DHX15

There are no specific blogs for DHX15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX15