DHRS2 Antibody - BSA Free

Western Blot: DHRS2 Antibody [NBP2-56196] - Analysis in human cell line SK-BR-3.

Immunocytochemistry/Immunofluorescence: DHRS2 Antibody [NBP2-56196] - Staining of human cell line RT4 shows localization to nucleus & mitochondria.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHRS2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHRS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DHRS2 Recombinant Protein Antigen (NBP2-56196PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DHRS2 Antibody - BSA Free

• dehydrogenase/reductase (SDR family) member 2
• dehydrogenase/reductase member 2
• dehydrogenase/reductase SDR family member 2
• Dicarbonyl reductase HEP27
• EC 1.1.1.-
• EC 1.1.1.184
• HEP27
• Protein D
• SDR25C1
• short chain dehydrogenase/reductase family 25C, member 1
• short-chain alcohol dehydrogenase family member

Background

DHRS2 may inhibit cell replication either by catalyzing the oxidation of estrogen and androgen or by converting cortisone in cortisol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHRS2