DGKH Antibody

Images

 
Immunohistochemistry-Paraffin: DGKH Antibody [NBP1-85229] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGKH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLN
Specificity
Specificity of human DGKH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGKH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DGKH Antibody

  • DAG kinase eta
  • DGKeta
  • DGK-eta
  • diacylglycerol kinase eta
  • diacylglycerol kinase, eta
  • Diglyceride kinase eta
  • DKFZp761I1510
  • EC 2.7.1.107

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5125
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB6727
Species: Hu
Applications: WB
NBP2-59310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-22439
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
AF5800
Species: Mu, Rt
Applications: WB, IHC
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PEP-ELISA
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00006925-M03
Species: Hu, Rt, Rb
Applications: WB, ELISA, ICC/IF
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7426
Species: Hu
Applications: WB
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
AF8216
Species: Hu, Mu, Rt
Applications: WB

Publications for DGKH Antibody (NBP1-85229) (0)

There are no publications for DGKH Antibody (NBP1-85229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGKH Antibody (NBP1-85229) (0)

There are no reviews for DGKH Antibody (NBP1-85229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DGKH Antibody (NBP1-85229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DGKH Products

Array NBP1-85229

Bioinformatics Tool for DGKH Antibody (NBP1-85229)

Discover related pathways, diseases and genes to DGKH Antibody (NBP1-85229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGKH Antibody (NBP1-85229)

Discover more about diseases related to DGKH Antibody (NBP1-85229).
 

Pathways for DGKH Antibody (NBP1-85229)

View related products by pathway.

Research Areas for DGKH Antibody (NBP1-85229)

Find related products by research area.

Blogs on DGKH

There are no specific blogs for DGKH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGKH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKH