DFF45/ICAD Recombinant Protein Antigen

Images

 
There are currently no images for DFF45/ICAD Protein (NBP1-85247PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DFF45/ICAD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DFFA.

Source: E.coli

Amino Acid Sequence: LRQSCAIVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTAL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DFFA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-85247.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DFF45/ICAD Recombinant Protein Antigen

  • DFF1
  • DFF1DNA fragmentation factor 45 kDa subunit
  • DFF45
  • DFF45DNA fragmentation factor subunit alpha
  • DFF-45DNA fragmentation factor, 45 kD, alpha polypeptide
  • DFFA
  • DNA fragmentation factor, 45kDa, alpha polypeptide
  • ICAD
  • Inhibitor of CAD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77009
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85247PEP
Species: Hu
Applications: AC

Publications for DFF45/ICAD Protein (NBP1-85247PEP) (0)

There are no publications for DFF45/ICAD Protein (NBP1-85247PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DFF45/ICAD Protein (NBP1-85247PEP) (0)

There are no reviews for DFF45/ICAD Protein (NBP1-85247PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DFF45/ICAD Protein (NBP1-85247PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DFF45/ICAD Products

Bioinformatics Tool for DFF45/ICAD Protein (NBP1-85247PEP)

Discover related pathways, diseases and genes to DFF45/ICAD Protein (NBP1-85247PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DFF45/ICAD Protein (NBP1-85247PEP)

Discover more about diseases related to DFF45/ICAD Protein (NBP1-85247PEP).
 

Pathways for DFF45/ICAD Protein (NBP1-85247PEP)

View related products by pathway.

PTMs for DFF45/ICAD Protein (NBP1-85247PEP)

Learn more about PTMs related to DFF45/ICAD Protein (NBP1-85247PEP).
 

Research Areas for DFF45/ICAD Protein (NBP1-85247PEP)

Find related products by research area.

Blogs on DFF45/ICAD

There are no specific blogs for DFF45/ICAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DFF45/ICAD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DFFA
Entrez