We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DFF40/CAD Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: DFF40/CAD Antibody [NBP2-55648] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

DFF40/CAD Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DFFB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP)

Reactivity Notes

Mouse 84%, Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DFF40/CAD Antibody - BSA Free

  • CAD
  • CADCaspase-activated nuclease
  • Caspase-activated deoxyribonuclease
  • Caspase-activated DNase
  • CPAN
  • CPANDNA fragmentation factor 40 kDa subunit
  • DFF2
  • DFF40
  • DFF-40DFF40DFF2DNA fragmentation factor subunit beta
  • DFFB
  • DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
  • EC 3.-

Background

Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. These death signals finally cause the degradation of chromosomal DNA by activated DNase. A mouse DNase that causes DNA fragmentation was identified recently and designated CAD (for caspase activated deoxyribonuclease). The human homologue of mouse CAD was more recently identified by two groups independently and termed CPAN and DFF40. Human DFF45 and its mouse homologue ICAD are the inhibitors of CPAN/DFF40 and CAD, respectively (1, 2, 5). Upon cleavage of DFF45/ICAD by activated caspase, DFF40/CAD is released and activated and eventually causes the degradation of DNA in the nuclei. Activation of CAD/DFF40, which causes DNA degradation, is the hallmark of apoptotic cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4679
Species: Hu
Applications: WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-44421
Species: Hu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-76657
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB868
Species: Hu
Applications: WB
AF1457
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-55648
Species: Hu
Applications: ICC/IF

Publications for DFF40/CAD Antibody (NBP2-55648) (0)

There are no publications for DFF40/CAD Antibody (NBP2-55648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DFF40/CAD Antibody (NBP2-55648) (0)

There are no reviews for DFF40/CAD Antibody (NBP2-55648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DFF40/CAD Antibody (NBP2-55648). (Showing 1 - 1 of 1 FAQ).

  1. Does Novus offer any CAD (caspase activated DNase) antibodies that specifically look at the activation state of CAD? And if so, how well does this antibody work with chicken?
    • CAD/DFF40/DFFB is inhibited by being bound by DFFA. Because of this manner of inhibition, antibodies will not be able to recognize the difference between activated and inhibited DFFB, so we do not have a product specifically for activated or inhibited DFFB and this product will probably be nearly impossible to make. Unfortunately, the human and chicken sequence appear to be divergent for any of our immunogens to recommend any antibody to test for cross-reactivity with chicken. I apologize for the inconvenience.

Secondary Antibodies

 

Isotype Controls

Additional DFF40/CAD Products

Research Areas for DFF40/CAD Antibody (NBP2-55648)

Find related products by research area.

Blogs on DFF40/CAD

There are no specific blogs for DFF40/CAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DFF40/CAD Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DFFB