Recombinant Human Desmin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Desmin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human DES partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Protein/Peptide Type
Partial Recombinant Protein
Gene
DES

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Desmin Protein

  • CMD1I
  • CMD1IFLJ41013
  • CSM1
  • CSM2
  • DES
  • Desmin
  • FLJ12025
  • FLJ39719
  • FLJ41793
  • intermediate filament protein

Background

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Desmin Partial Recombinant Protein (H00001674-Q01) (0)

There are no publications for Desmin Partial Recombinant Protein (H00001674-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmin Partial Recombinant Protein (H00001674-Q01) (0)

There are no reviews for Desmin Partial Recombinant Protein (H00001674-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Desmin Partial Recombinant Protein (H00001674-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Desmin Products

Bioinformatics Tool for Desmin Partial Recombinant Protein (H00001674-Q01)

Discover related pathways, diseases and genes to Desmin Partial Recombinant Protein (H00001674-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmin Partial Recombinant Protein (H00001674-Q01)

Discover more about diseases related to Desmin Partial Recombinant Protein (H00001674-Q01).
 

Pathways for Desmin Partial Recombinant Protein (H00001674-Q01)

View related products by pathway.

PTMs for Desmin Partial Recombinant Protein (H00001674-Q01)

Learn more about PTMs related to Desmin Partial Recombinant Protein (H00001674-Q01).
 

Research Areas for Desmin Partial Recombinant Protein (H00001674-Q01)

Find related products by research area.

Blogs on Desmin.

Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology
Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t...  Read full blog post.

Vimentin in Wound Healing
Vimentin is a fundamental 10 nm type III intermediate filament (IF) protein found in many mesenchymal and epithelia tissues, tissue culture cells, and developing neuronal and astrocytic precursor cells of the central nervous system. It frequently co-p...  Read full blog post.

Customers Who Bought This Also Bought

Desmin Antibody
NB120-15200-0.1ml
GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Desmin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DES
Entrez