Western Blot: Dermcidin Antibody [NBP2-92673] - analysis of HeLa, using DCD antibody at 1:8000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking ...read more
Western Blot: Dermcidin Antibody [NBP2-92673] - analysis of 293T, using DCD antibody at 1:8000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking ...read more
Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human DCD (NP_444513.1). YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCD
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Dermcidin is a protein that has three isoforms, with lengths of 110, 121, and 77 amino acids and weights of approximately 11, 12, and 8 kDa respectively. Dermcidin limits the skin infection of pathogens after a bacterial infection due to its antimicrobial activity as well as functions to aid in phosphatase activity and the survival of neurons. Current studies are being done on several diseases and disorders linked to this protein including clear cell hidradenoma, root caries, angiomyoma, skin conditions, myocardial infarction, hidrocystoma, atopic dermatitis, squamous cell carcinoma, vaginitis, breast cancer, lung cancer, and prostate cancer. Dermcidin has also been shown to have interactions with FAM107A, INPP5K, MDM2, TNFRSF14, and SUMO2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Dermcidin Antibody - BSA Free and receive a gift card or discount.