Dermcidin Antibody - BSA Free

Western Blot: Dermcidin Antibody [NBP2-92673] - analysis of HeLa, using DCD antibody at 1:8000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: Dermcidin Antibody [NBP2-92673] - analysis of 293T, using DCD antibody at 1:8000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dermcidin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dermcidin Antibody - BSA Free (NBP2-92673) is a polyclonal antibody validated for use in IHC and WB. Anti-Dermcidin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human DCD (NP_444513.1). YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:2000 - 1:9000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dermcidin Antibody - BSA Free

• AIDDdiffusible survival/evasion peptide
• DCD-1
• dermcidin
• DSEPpreproteolysin
• HCAP
• MGC71930
• PIF
• Preproteolysin
• proteolysis inducing factor
• survival promoting peptide

Background

Dermcidin is a protein that has three isoforms, with lengths of 110, 121, and 77 amino acids and weights of approximately 11, 12, and 8 kDa respectively. Dermcidin limits the skin infection of pathogens after a bacterial infection due to its antimicrobial activity as well as functions to aid in phosphatase activity and the survival of neurons. Current studies are being done on several diseases and disorders linked to this protein including clear cell hidradenoma, root caries, angiomyoma, skin conditions, myocardial infarction, hidrocystoma, atopic dermatitis, squamous cell carcinoma, vaginitis, breast cancer, lung cancer, and prostate cancer. Dermcidin has also been shown to have interactions with FAM107A, INPP5K, MDM2, TNFRSF14, and SUMO2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dermcidin Antibody (NBP2-92673)(1)

Publication using NBP2-92673

• Li T, Su X, Lu P et al. Bone Marrow Mesenchymal Stem Cell-Derived Dermcidin-Containing Migrasomes enhance LC3-Associated Phagocytosis of Pulmonary Macrophages and Protect against Post-Stroke Pneumonia Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2023-05-28 [PMID: 37246283] (IHC-Fr, Mouse)
  
  Details:
  1:300 IHC-Fr dilution

Bioinformatics

• Gene Symbol: DCD