Dermcidin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DCD |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Dermcidin Antibody - BSA Free
Background
Dermcidin is a protein that has three isoforms, with lengths of 110, 121, and 77 amino acids and weights of approximately 11, 12, and 8 kDa respectively. Dermcidin limits the skin infection of pathogens after a bacterial infection due to its antimicrobial activity as well as functions to aid in phosphatase activity and the survival of neurons. Current studies are being done on several diseases and disorders linked to this protein including clear cell hidradenoma, root caries, angiomyoma, skin conditions, myocardial infarction, hidrocystoma, atopic dermatitis, squamous cell carcinoma, vaginitis, breast cancer, lung cancer, and prostate cancer. Dermcidin has also been shown to have interactions with FAM107A, INPP5K, MDM2, TNFRSF14, and SUMO2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Mu
Applications: ICC/IF (-), IHC, IHC-P, WB (-)
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, WB
Publications for Dermcidin Antibody (NBP2-56558) (0)
There are no publications for Dermcidin Antibody (NBP2-56558).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dermcidin Antibody (NBP2-56558) (0)
There are no reviews for Dermcidin Antibody (NBP2-56558).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Dermcidin Antibody (NBP2-56558) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dermcidin Products
Research Areas for Dermcidin Antibody (NBP2-56558)
Find related products by research area.
|
Blogs on Dermcidin