Derlin 1 Antibody


Western Blot: Derlin 1 Antibody [NBP1-88023] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: Derlin 1 Antibody [NBP1-88023] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells and in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Derlin 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Specificity of human Derlin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Control Peptide
Derlin 1 Protein (NBP1-88023PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Derlin 1 Antibody

  • DER-1
  • DER1Degradation in endoplasmic reticulum protein 1
  • Der1-like domain family, member 1
  • Der1-like protein 1
  • derlin-1
  • DERtrin-1
  • FLJ13784
  • FLJ42092
  • MGC3067
  • PRO2577


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Derlin 1 Antibody (NBP1-88023) (0)

There are no publications for Derlin 1 Antibody (NBP1-88023).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Derlin 1 Antibody (NBP1-88023) (0)

There are no reviews for Derlin 1 Antibody (NBP1-88023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Derlin 1 Antibody (NBP1-88023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Derlin 1 Products

Bioinformatics Tool for Derlin 1 Antibody (NBP1-88023)

Discover related pathways, diseases and genes to Derlin 1 Antibody (NBP1-88023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Derlin 1 Antibody (NBP1-88023)

Discover more about diseases related to Derlin 1 Antibody (NBP1-88023).

Pathways for Derlin 1 Antibody (NBP1-88023)

View related products by pathway.

PTMs for Derlin 1 Antibody (NBP1-88023)

Learn more about PTMs related to Derlin 1 Antibody (NBP1-88023).

Research Areas for Derlin 1 Antibody (NBP1-88023)

Find related products by research area.

Blogs on Derlin 1

There are no specific blogs for Derlin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Derlin 1 Antibody and receive a gift card or discount.


Gene Symbol DERL1