Derlin 1 Antibody

Images

 
Western Blot: Derlin 1 Antibody [NBP1-88023] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: Derlin 1 Antibody [NBP1-88023] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells and in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Derlin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DERL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Control Peptide
Derlin 1 Protein (NBP1-88023PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Derlin 1 Antibody

  • DER-1
  • DER1Degradation in endoplasmic reticulum protein 1
  • Der1-like domain family, member 1
  • Der1-like protein 1
  • derlin-1
  • DERtrin-1
  • FLJ13784
  • FLJ42092
  • MGC3067
  • PRO2577

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-47485
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-16152
Species: Hu
Applications: WB
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP2-46289
Species: Hu
Applications: WB, IHC
NBP1-84905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Derlin 1 Antibody (NBP1-88023) (0)

There are no publications for Derlin 1 Antibody (NBP1-88023).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Derlin 1 Antibody (NBP1-88023) (0)

There are no reviews for Derlin 1 Antibody (NBP1-88023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Derlin 1 Antibody (NBP1-88023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Derlin 1 Products

Bioinformatics Tool for Derlin 1 Antibody (NBP1-88023)

Discover related pathways, diseases and genes to Derlin 1 Antibody (NBP1-88023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Derlin 1 Antibody (NBP1-88023)

Discover more about diseases related to Derlin 1 Antibody (NBP1-88023).
 

Pathways for Derlin 1 Antibody (NBP1-88023)

View related products by pathway.

PTMs for Derlin 1 Antibody (NBP1-88023)

Learn more about PTMs related to Derlin 1 Antibody (NBP1-88023).
 

Research Areas for Derlin 1 Antibody (NBP1-88023)

Find related products by research area.

Blogs on Derlin 1

There are no specific blogs for Derlin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Derlin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DERL1