DENND1B Antibody

Images

 
Western Blot: DENND1B Antibody [NBP1-69245] - This Anti-DENND1B antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DENND1B Antibody Summary

Immunogen
Synthetic peptides corresponding to DENND1B(DENN/MADD domain containing 1B) The peptide sequence was selected from the middle region of DENND1B. Peptide sequence PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DENND1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DENND1B and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DENND1B Antibody

  • C1ORF18
  • C1orf218
  • chromosome 1 open reading frame 218
  • Connecdenn 2
  • DENN domain-containing protein 1B
  • DENN/MADD domain containing 1B
  • DKFZp547O0715
  • FAM31BMGC103810
  • FLJ20054
  • FLJ21179
  • FLJ33888
  • member B
  • Protein FAM31B

Background

DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB190
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
NBP1-55325
Species: Hu
Applications: WB
DDX0700P-100
Species: Hu, Ca
Applications: B/N, Flow, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20042
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88826
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3578
Species: Hu, Mu
Applications: WB, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP2-14345
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-98511
Species: Hu
Applications: WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
NBP1-69245
Species: Hu
Applications: WB

Publications for DENND1B Antibody (NBP1-69245) (0)

There are no publications for DENND1B Antibody (NBP1-69245).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DENND1B Antibody (NBP1-69245) (0)

There are no reviews for DENND1B Antibody (NBP1-69245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DENND1B Antibody (NBP1-69245) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DENND1B Products

Bioinformatics Tool for DENND1B Antibody (NBP1-69245)

Discover related pathways, diseases and genes to DENND1B Antibody (NBP1-69245). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DENND1B Antibody (NBP1-69245)

Discover more about diseases related to DENND1B Antibody (NBP1-69245).
 

Pathways for DENND1B Antibody (NBP1-69245)

View related products by pathway.

Blogs on DENND1B

There are no specific blogs for DENND1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DENND1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DENND1B
Uniprot