delta 2 Catenin Antibody

Images

 
Immunohistochemistry-Paraffin: delta 2 Catenin Antibody [NBP2-47487] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry: delta 2 Catenin Antibody [NBP2-47487] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells, neuropil displayed moderate cytoplasmic staining.
Immunohistochemistry-Paraffin: delta 2 Catenin Antibody [NBP2-47487] - Staining in human cerebral cortex and pancreas tissues using anti-CTNND2 antibody. Corresponding CTNND2 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

delta 2 Catenin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASQLERCKLGSETGSMSSMSSAEEQFQWQSQDGQKDIEDELTTGLELVDSCIRSLQESGILDPQDYSTGERPSLLSQSALQLNSKPEGSFQYPASYHSNQTLALGETTPSQLPARGTQARATGQSFSQGTTSRA
Specificity
Specificity of human delta 2 Catenin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTNND2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
delta 2 Catenin Protein (NBP2-47487PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for delta 2 Catenin Antibody

  • catenin (cadherin-associated protein), delta 2 (neural plakophilin-relatedarm-repeat protein)
  • catenin delta-2
  • Delta-catenin
  • GT24T-cell delta-catenin
  • Neural plakophilin-related ARM-repeat protein
  • Neurojungin
  • NPRAPneurojungin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008502-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-38999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-47487
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for delta 2 Catenin Antibody (NBP2-47487) (0)

There are no publications for delta 2 Catenin Antibody (NBP2-47487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for delta 2 Catenin Antibody (NBP2-47487) (0)

There are no reviews for delta 2 Catenin Antibody (NBP2-47487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for delta 2 Catenin Antibody (NBP2-47487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for delta 2 Catenin Antibody (NBP2-47487)

Discover related pathways, diseases and genes to delta 2 Catenin Antibody (NBP2-47487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for delta 2 Catenin Antibody (NBP2-47487)

Discover more about diseases related to delta 2 Catenin Antibody (NBP2-47487).
 

Pathways for delta 2 Catenin Antibody (NBP2-47487)

View related products by pathway.

PTMs for delta 2 Catenin Antibody (NBP2-47487)

Learn more about PTMs related to delta 2 Catenin Antibody (NBP2-47487).
 

Research Areas for delta 2 Catenin Antibody (NBP2-47487)

Find related products by research area.

Blogs on delta 2 Catenin

There are no specific blogs for delta 2 Catenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our delta 2 Catenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNND2