Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

Western Blot: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-55231] - Human Placenta lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DHDDS(dehydrodolichyl diphosphate synthase) The peptide sequence was selected from the N terminal of DHDDS. Peptide sequence NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHDDS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

• cis-isoprenyltransferase
• cis-prenyl transferase
• CIT
• CPT
• Dedol-PP synthase
• dehydrodolichyl diphosphate synthase
• EC 2.5.1.-
• FLJ13102
• HDSDS

Background

Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-301 BX648507.1 32-332 302-886 AB090852.1 192-776 887-2199 AK023164.1 846-2158 2200-2425 BX648507.1 2251-2476 2426-3011 AK023164.1 2387-2972 3012-3257 BX648507.1 3063-3308 3258-3315 BQ028814.1 1-58 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHDDS
• Uniprot:
  • Q86SQ9(Human)