Dehydrodolichyl Diphosphate Synthase Antibody

Images

 
Western Blot: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-55231] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dehydrodolichyl Diphosphate Synthase Antibody Summary

Immunogen
Synthetic peptides corresponding to DHDDS(dehydrodolichyl diphosphate synthase) The peptide sequence was selected from the N terminal of DHDDS. Peptide sequence NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHDDS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DHDDS and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dehydrodolichyl Diphosphate Synthase Antibody

  • cis-isoprenyltransferase
  • cis-prenyl transferase
  • CIT
  • CPT
  • Dedol-PP synthase
  • dehydrodolichyl diphosphate synthase
  • EC 2.5.1.-
  • FLJ13102
  • HDSDS

Background

Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-301 BX648507.1 32-332 302-886 AB090852.1 192-776 887-2199 AK023164.1 846-2158 2200-2425 BX648507.1 2251-2476 2426-3011 AK023164.1 2387-2972 3012-3257 BX648507.1 3063-3308 3258-3315 BQ028814.1 1-58 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-50748
Species: Hu, Mu, Rt, Ca, Eq, Ha
Applications: WB, Simple Western
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-90365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231) (0)

There are no publications for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231) (0)

There are no reviews for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Dehydrodolichyl Diphosphate Synthase Products

Bioinformatics Tool for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231)

Discover related pathways, diseases and genes to Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231)

Discover more about diseases related to Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231).
 

Pathways for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231)

View related products by pathway.

PTMs for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231)

Learn more about PTMs related to Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-55231).

Blogs on Dehydrodolichyl Diphosphate Synthase

There are no specific blogs for Dehydrodolichyl Diphosphate Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dehydrodolichyl Diphosphate Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHDDS
Uniprot