Defensin alpha 5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Defensin alpha 5 Antibody [NBP3-17669] - Staining of human cell line SH-SY5Y shows localization to midbody & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Defensin alpha 5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEFA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Defensin alpha 5 Antibody - BSA Free

• alpha-Defensin 5
• DEF5
• DEF5defensin, alpha 5, preproprotein
• DEFA5
• defensin 5
• Defensin alpha 5
• Defensin, alpha 5
• defensin, alpha 5, Paneth cell-specific
• defensin-5
• HD-5
• MGC129728

Background

Defensin alpha 5 (DEFA5) is primarily responsible for host defense. DEFA5 has shown antimicrobial activity and is thought to kill microbes by permeabilizing their plasma membrane. This protein is highly expressed in the secretory granules of Paneth cells of the ileum.

Defensin alpha 5 antibodies are useful tools for bacterial defense studies and human immunology research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEFA5