Decorin Recombinant Protein Antigen

Images

 
There are currently no images for Decorin Recombinant Protein Antigen (NBP2-56346PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Decorin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Decorin.

Source: E. coli

Amino Acid Sequence: VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56346.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Decorin Recombinant Protein Antigen

  • Bone proteoglycan II
  • CSCD
  • DCN
  • decorin proteoglycan
  • Decorin
  • dermatan sulphate proteoglycans II
  • DSPG2
  • PG40
  • PGII
  • PG-II
  • PGS2
  • PG-S2
  • proteoglycan core protein
  • SLRR1B
  • SLRR1BPGS2
  • small leucine-rich protein 1B

Background

Decorin is encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. The encoded protein and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2667
Species: Hu
Applications: IHC, WB
AF3054
Species: Hu
Applications: ICC, IHC, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF5945
Species: Hu, Mu, Rt
Applications: WB
AF2846
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NBP1-86687
Species: Hu
Applications: IHC, IHC-P, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB

Publications for Decorin Recombinant Protein Antigen (NBP2-56346PEP) (0)

There are no publications for Decorin Recombinant Protein Antigen (NBP2-56346PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Decorin Recombinant Protein Antigen (NBP2-56346PEP) (0)

There are no reviews for Decorin Recombinant Protein Antigen (NBP2-56346PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Decorin Recombinant Protein Antigen (NBP2-56346PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Decorin Products

Research Areas for Decorin Recombinant Protein Antigen (NBP2-56346PEP)

Find related products by research area.

Blogs on Decorin

There are no specific blogs for Decorin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Decorin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCN