DEC2/SHARP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DEC2/SHARP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEC2/SHARP1.

  Source: E. coli

  Amino Acid Sequence: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BHLHE41
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58737.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DEC2/SHARP1 Recombinant Protein Antigen

• basic helix-loop-helix domain containing, class B, 3
• basic helix-loop-helix family, member e41
• BHLHB3
• BHLHB3class E basic helix-loop-helix protein 41
• BHLHE41
• Class B basic helix-loop-helix protein 3
• DEC2
• DEC2Enhancer-of-split and hairy-related protein 1
• Differentially expressed in chondrocytes protein 2
• SHARP-1
• SHARP1hDEC2

Background

Human DEC1 is a 412 amino acid, basic helix-loop-helix (bHLH) containing protein that is involved in the control of proliferation and/or differentiation of several cell types including nerve cells, fibroblasts and chondrocytes. The bHLH region of DEC1 is structurally similar to the bHLH regions of the mammalian HES family, Drosophila hairy, and Enhancer of split m7. DEC1 is a novel direct target for cAMP in a wide range of cells, and is involved in the control of gene expression in cAMP-activated cells. DEC2, also known as SHARP1, is highly expressed in skeletal muscle and brain. The gene encoding human DEC2 maps to chromosome 12p11.23-p12.1. DEC1 and DEC2 play a role in regulating the mammalian molecular clock by suppressing the transcription of specific clock genes. Both DEC1 and DEC2 are detected in the suprachiasmimc nucleus in a circadian fashion. Brief light impulses induce the expression of DEC1 in a phase-dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BHLHE41