Recombinant Human DEC2/SHARP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DEC2/SHARP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 203-282 of Human BHLHB3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BHLHE41

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DEC2/SHARP1 Protein

  • basic helix-loop-helix domain containing, class B, 3
  • basic helix-loop-helix family, member e41
  • BHLHB3
  • BHLHB3class E basic helix-loop-helix protein 41
  • BHLHE41
  • Class B basic helix-loop-helix protein 3
  • DEC2
  • DEC2Enhancer-of-split and hairy-related protein 1
  • Differentially expressed in chondrocytes protein 2
  • SHARP-1
  • SHARP1hDEC2

Background

BHLHB3 - basic helix-loop-helix domain containing, class B, 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP1-55505
Species: Hu
Applications: WB
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00079365-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01) (0)

There are no publications for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01) (0)

There are no reviews for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DEC2/SHARP1 Products

Bioinformatics Tool for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01)

Discover related pathways, diseases and genes to DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01)

Discover more about diseases related to DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01).
 

Pathways for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01)

View related products by pathway.

PTMs for DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01)

Learn more about PTMs related to DEC2/SHARP1 Partial Recombinant Protein (H00079365-Q01).

Blogs on DEC2/SHARP1.

SHARP1 - An enhancer-of-split- and hairy-related protein
SHARP1 encodes a transcription repressor factor that belongs to the Hairy/Enhancer of the Split subfamily of basic helix-loop-helix factors (bHLH). Sequence alignment shows that SHARP1 is only distantly related to these proteins with a 37-42% sequence...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DEC2/SHARP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BHLHE41
Entrez