DEC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DEC1 Antibody [NBP2-47488] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear bodies.

Immunohistochemistry-Paraffin: DEC1 Antibody [NBP2-47488] - Staining of human urinary bladder shows moderate to strong nuclear positivity in urothelial cells.

Western Blot: DEC1 Antibody [NBP2-47488] - Analysis in human cell line HDLM-2.

Immunohistochemistry-Paraffin: DEC1 Antibody [NBP2-47488] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: DEC1 Antibody [NBP2-47488] - Staining of human lymph node shows moderate nuclear positivity in a small subset of cells in non-germinal center.

Immunohistochemistry: DEC1 Antibody [NBP2-47488] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: DEC1 Antibody [NBP2-47488] - Staining of human prostate shows moderate to strong nuclear positivity in smooth muscle cells.

ChIP-Exo-Seq composite graph for Anti-BHLHE40 (NBP2-47488) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DEC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BHLHE40
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DEC1 Protein (NBP2-47488PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DEC1 Antibody - BSA Free

• basic helix-loop-helix domain containing, class B, 2
• basic helix-loop-helix family, member e40
• bHLHb2
• bHLHe40
• Class B basic helix-loop-helix protein 2
• class E basic helix-loop-helix protein 40
• DEC1HLHB2
• differentially expressed in chondrocytes 1
• Differentially expressed in chondrocytes protein 1
• differentiated embryo chondrocyte expressed gene 1
• Enhancer-of-split and hairy-related protein 2
• SHARP2
• SHARP-2
• Stimulated by retinoic acid gene 13 protein
• STRA13FLJ99214
• Stra14

Background

DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BHLHE40