DEAF1 Antibody (2A2) - Azide and BSA Free Summary
| Immunogen |
DEAF1 (NP_066288.2, 133 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG |
| Specificity |
DEAF1 (2A2) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
DEAF1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against tissue lysate for western blot. It has also been used for ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DEAF1 Antibody (2A2) - Azide and BSA Free
Background
Transcription factor that binds to sequence with multiple copies of TTC[CG]G present in its own promoter and that of the HNRPA2B1 gene. Down-regulates transcription of these genes. Binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. Activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: BA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for DEAF1 Antibody (H00010522-M07) (0)
There are no publications for DEAF1 Antibody (H00010522-M07).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DEAF1 Antibody (H00010522-M07) (0)
There are no reviews for DEAF1 Antibody (H00010522-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DEAF1 Antibody (H00010522-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DEAF1 Products
Blogs on DEAF1