DEAF1 Antibody (2A2) - Azide and BSA Free

Western Blot: DEAF1 Antibody (2A2) [H00010522-M07] - Analysis of DEAF1 expression in human parotid gland.

Immunocytochemistry/Immunofluorescence: DEAF1 Antibody (2A2) [H00010522-M07] - Analysis of monoclonal antibody to DEAF1 on HeLa cell. Antibody concentration 10 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2A2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DEAF1 Antibody (2A2) - Azide and BSA Free Summary

• Immunogen: DEAF1 (NP_066288.2, 133 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG
• Specificity: DEAF1 (2A2)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DEAF1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against tissue lysate for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DEAF1 Antibody (2A2) - Azide and BSA Free

• deformed epidermal autoregulatory factor 1 (Drosophila)
• Nuclear DEAF-1-related transcriptional regulator
• NUDRdeformed epidermal autoregulatory factor 1 homolog
• SPNsuppressin
• Zinc finger MYND domain-containing protein 5
• ZMYND5Suppressin

Background

Transcription factor that binds to sequence with multiple copies of TTC[CG]G present in its own promoter and that of the HNRPA2B1 gene. Down-regulates transcription of these genes. Binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. Activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEAF1
• Entrez:
  • 10522(Human)
• OMIM:
  • 602635(Human)
• Uniprot:
  • NP_066288(Human)