DDX41 Antibody

Images

 
Western Blot: DDX41 Antibody [NBP1-89297] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DDX41 Antibody [NBP1-89297] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DDX41 Antibody [NBP1-89297] - Staining of human duodenum shows nuclear and cytoplasmic positivity in glandular cells.
Western Blot: DDX41 Antibody [NBP1-89297] - Analysis in human cell line CACO-2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX41
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX41 Protein (NBP1-89297PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX41 Antibody

  • ABSDEAD-box protein abstrakt
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
  • DEAD box protein 41
  • DEAD box protein abstrakt homolog
  • EC 3.6.1
  • EC 3.6.4.13,2900024F02Rik
  • MGC8828
  • probable ATP-dependent RNA helicase DDX41
  • putative RNA helicase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-490
Species: Hu, Mu
Applications: WB, ICC/IF
AF2030
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-59677
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P

Publications for DDX41 Antibody (NBP1-89297) (0)

There are no publications for DDX41 Antibody (NBP1-89297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX41 Antibody (NBP1-89297) (0)

There are no reviews for DDX41 Antibody (NBP1-89297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX41 Antibody (NBP1-89297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX41 Products

Bioinformatics Tool for DDX41 Antibody (NBP1-89297)

Discover related pathways, diseases and genes to DDX41 Antibody (NBP1-89297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX41 Antibody (NBP1-89297)

Discover more about diseases related to DDX41 Antibody (NBP1-89297).
 

Pathways for DDX41 Antibody (NBP1-89297)

View related products by pathway.

PTMs for DDX41 Antibody (NBP1-89297)

Learn more about PTMs related to DDX41 Antibody (NBP1-89297).
 

Research Areas for DDX41 Antibody (NBP1-89297)

Find related products by research area.

Blogs on DDX41

There are no specific blogs for DDX41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX41