DDX41 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX41 Antibody [NBP1-89297] - Staining in human small intestine and pancreas tissues using anti-DDX41 antibody. Corresponding DDX41 RNA-seq data are presented for the same tissues.

Western Blot: DDX41 Antibody [NBP1-89297] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: DDX41 Antibody [NBP1-89297] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DDX41 Antibody [NBP1-89297] - Staining of human small intestine shows high expression.

Western Blot: DDX41 Antibody [NBP1-89297] - Analysis in human cell line CACO-2.

Immunohistochemistry-Paraffin: DDX41 Antibody [NBP1-89297] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX41 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX41
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX41 Protein (NBP1-89297PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX41 Antibody - BSA Free

• ABSDEAD-box protein abstrakt
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
• DEAD box protein 41
• DEAD box protein abstrakt homolog
• EC 3.6.1
• EC 3.6.4.13,2900024F02Rik
• MGC8828
• probable ATP-dependent RNA helicase DDX41
• putative RNA helicase

Background

DDX41, also known as Probable ATP-dependent RNA helicase DDX41, is a 69.8 kDa, 622 amino acid protein that is involved in gene expression after transcription as a member of the DEAD box protein family. Current research is being conducted for diseases and disorders such as immunodeficiency, nephritis, tetanus, embryonal carcinoma, hepatitis, spinal muscular atrophy, lyme disease, and neuroblastoma. The protein is a part of the RNA processing pathway, where it interacts with NKAP, CDC5L, CCNB1, USP36, and SNW1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX41