DDX41 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit DDX41 Antibody - BSA Free (NBP1-89297) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DDX41 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for DDX41 Antibody - BSA Free
Background
DDX41, also known as Probable ATP-dependent RNA helicase DDX41, is a 69.8 kDa, 622 amino acid protein that is involved in gene expression after transcription as a member of the DEAD box protein family. Current research is being conducted for diseases and disorders such as immunodeficiency, nephritis, tetanus, embryonal carcinoma, hepatitis, spinal muscular atrophy, lyme disease, and neuroblastoma. The protein is a part of the RNA processing pathway, where it interacts with NKAP, CDC5L, CCNB1, USP36, and SNW1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Ha, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for DDX41 Antibody (NBP1-89297) (0)
There are no publications for DDX41 Antibody (NBP1-89297).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DDX41 Antibody (NBP1-89297) (0)
There are no reviews for DDX41 Antibody (NBP1-89297).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DDX41 Antibody (NBP1-89297) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DDX41 Products
Research Areas for DDX41 Antibody (NBP1-89297)
Find related products by research area.
|
Blogs on DDX41