Recombinant Human DDX17 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DDX17 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-183 of Human DDX17 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQLVDHRGGGGGGGKGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DDX17
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DDX17 Protein

  • DDX17
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 17
  • DEAD box protein 17
  • DEAD box protein p72
  • DEAD/H box 17
  • DKFZp761H2016
  • EC 3.6.1
  • EC 3.6.4.13
  • p72
  • P72DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)
  • probable ATP-dependent RNA helicase DDX17
  • RH70
  • RNA-dependent helicase p72

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA. This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member of the DEAD box family. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
H00054606-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
H00010521-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DDX17 Recombinant Protein (H00010521-P01) (0)

There are no publications for DDX17 Recombinant Protein (H00010521-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX17 Recombinant Protein (H00010521-P01) (0)

There are no reviews for DDX17 Recombinant Protein (H00010521-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX17 Recombinant Protein (H00010521-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX17 Products

Bioinformatics Tool for DDX17 Recombinant Protein (H00010521-P01)

Discover related pathways, diseases and genes to DDX17 Recombinant Protein (H00010521-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX17 Recombinant Protein (H00010521-P01)

Discover more about diseases related to DDX17 Recombinant Protein (H00010521-P01).
 

Pathways for DDX17 Recombinant Protein (H00010521-P01)

View related products by pathway.

PTMs for DDX17 Recombinant Protein (H00010521-P01)

Learn more about PTMs related to DDX17 Recombinant Protein (H00010521-P01).
 

Research Areas for DDX17 Recombinant Protein (H00010521-P01)

Find related products by research area.

Blogs on DDX17

There are no specific blogs for DDX17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX17 Antibody
NB200-352

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DDX17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX17
Entrez