DDX17 Antibody - Azide and BSA Free

Western Blot: DDX17 Antibody [NBP2-92878] - Analysis of extracts of various cell lines, using DDX17 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5min.

Immunocytochemistry/ Immunofluorescence: DDX17 Antibody - Azide and BSA Free [NBP2-92878] - Immunofluorescence analysis of U2OS cells using DDX17 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Product Discontinued

DDX17 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-240 of human DDX17 (NP_006377.2). VFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for DDX17 Antibody - Azide and BSA Free

• DDX17
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 17
• DEAD box protein 17
• DEAD box protein p72
• DEAD/H box 17
• DKFZp761H2016
• EC 3.6.1
• EC 3.6.4.13
• p72
• P72DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)
• probable ATP-dependent RNA helicase DDX17
• RH70
• RNA-dependent helicase p72

Background

DDX17 (p72) is a highly related member of the DEAD box family and is an established RNA helicase. It has been implicated in growth regulation and has been shown to be involved in both pre-mRNA and pre-rRNA processing. This protein has also been reported to act as a transcriptional co-activator for estrogen-receptor alpha (ER ) and shown to interact with co-activators p300/CBP and the RNA polymerase II holoenzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: DDX17