DDX1 Antibody (4F6)

Images

 
Western Blot: DDX1 Antibody (4F6) [H00001653-M02] - DDX1 monoclonal antibody (M02), clone 4F6. Analysis of DDX1 expression in Hela S3 NE.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DDX1 Antibody (4F6) Summary

Immunogen
DDX1 (NP_004930 642 a.a. - 740 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
Specificity
DDX1 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 (4F6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DDX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDX1 Antibody (4F6)

  • ATP-dependent RNA helicase DDX1
  • DBP-RBDEAD box polypeptide 1
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
  • DEAD box protein 1
  • DEAD box protein retinoblastoma
  • DEAD box-1
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1
  • EC 3.6.1
  • EC 3.6.1.10
  • EC 3.6.4.13
  • UKVH5d

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
AF755
Species: Mu
Applications: WB, Block
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001653-M02
Species: Hu
Applications: WB, ELISA

Publications for DDX1 Antibody (H00001653-M02) (0)

There are no publications for DDX1 Antibody (H00001653-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX1 Antibody (H00001653-M02) (0)

There are no reviews for DDX1 Antibody (H00001653-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX1 Antibody (H00001653-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX1 Products

Bioinformatics Tool for DDX1 Antibody (H00001653-M02)

Discover related pathways, diseases and genes to DDX1 Antibody (H00001653-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX1 Antibody (H00001653-M02)

Discover more about diseases related to DDX1 Antibody (H00001653-M02).
 

Pathways for DDX1 Antibody (H00001653-M02)

View related products by pathway.

PTMs for DDX1 Antibody (H00001653-M02)

Learn more about PTMs related to DDX1 Antibody (H00001653-M02).
 

Research Areas for DDX1 Antibody (H00001653-M02)

Find related products by research area.

Blogs on DDX1

There are no specific blogs for DDX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX1 Antibody (4F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX1
Entrez
Uniprot