DDIT4L Antibody


Western Blot: DDIT4L Antibody [NBP1-55005] - 293T Whole Cell lysates, Antibody Dilution: 0.1 ug/ml.
Western Blot: DDIT4L Antibody [NBP1-55005] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: DDIT4L Antibody [NBP1-55005] - 293T Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DDIT4L Antibody Summary

Synthetic peptides corresponding to DDIT4L(DNA-damage-inducible transcript 4-like) The peptide sequence was selected from the middle region of DDIT4L (NP_660287). Peptide sequence KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DDIT4L Antibody

  • DNA damage-inducible transcript 4-like protein
  • DNA-damage-inducible transcript 4-like
  • HIF-1 responsive protein RTP801-like
  • homolog of mouse SMHS1
  • Protein regulated in development and DNA damage response 2
  • REDD-2
  • REDD2Rtp801L
  • regulated in development and DNA damage response 2
  • RTP801L


DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DDIT4L Antibody (NBP1-55005) (0)

There are no publications for DDIT4L Antibody (NBP1-55005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDIT4L Antibody (NBP1-55005) (0)

There are no reviews for DDIT4L Antibody (NBP1-55005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDIT4L Antibody (NBP1-55005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DDIT4L Products

Bioinformatics Tool for DDIT4L Antibody (NBP1-55005)

Discover related pathways, diseases and genes to DDIT4L Antibody (NBP1-55005). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDIT4L Antibody (NBP1-55005)

Discover more about diseases related to DDIT4L Antibody (NBP1-55005).

Pathways for DDIT4L Antibody (NBP1-55005)

View related products by pathway.

PTMs for DDIT4L Antibody (NBP1-55005)

Learn more about PTMs related to DDIT4L Antibody (NBP1-55005).

Research Areas for DDIT4L Antibody (NBP1-55005)

Find related products by research area.

Blogs on DDIT4L

There are no specific blogs for DDIT4L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDIT4L Antibody and receive a gift card or discount.


Gene Symbol DDIT4L