Recombinant Human DBF4B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DBF4B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-170 of Human DRF1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DBF4B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DBF4B Protein

  • Activator of S phase kinase-like protein 1
  • activator of S-phase kinase-like protein 1
  • ASKL1CHIFB
  • ASK-like protein 1
  • chifb
  • Chiffon homolog B
  • DBF4 homolog B (S. cerevisiae)
  • Dbf4-related factor 1
  • DRF1MGC15009
  • FLJ13087
  • protein DBF4 homolog B
  • ZDBF1B
  • zinc finger, DBF-type containing 1B

Background

This gene encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full length sequences have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-230
Species: Hu
Applications: WB
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
AF1444
Species: Mu
Applications: WB, IHC
MAB2878
Species: Hu
Applications: Flow, CyTOF-ready
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00080174-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DBF4B Recombinant Protein (H00080174-P01) (0)

There are no publications for DBF4B Recombinant Protein (H00080174-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBF4B Recombinant Protein (H00080174-P01) (0)

There are no reviews for DBF4B Recombinant Protein (H00080174-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DBF4B Recombinant Protein (H00080174-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DBF4B Products

Bioinformatics Tool for DBF4B Recombinant Protein (H00080174-P01)

Discover related pathways, diseases and genes to DBF4B Recombinant Protein (H00080174-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DBF4B

There are no specific blogs for DBF4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DBF4B Antibody
NBP2-13900

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DBF4B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DBF4B