DBF4B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DBF4B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DBF4B
  
  

  Source: E.coli

  Amino Acid Sequence: GKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DBF4B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24777It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DBF4B Recombinant Protein Antigen

• Activator of S phase kinase-like protein 1
• activator of S-phase kinase-like protein 1
• ASKL1CHIFB
• ASK-like protein 1
• chifb
• Chiffon homolog B
• DBF4 homolog B (S. cerevisiae)
• Dbf4-related factor 1
• DRF1MGC15009
• FLJ13087
• protein DBF4 homolog B
• ZDBF1B
• zinc finger, DBF-type containing 1B

Background

DBF4B, also known as Protein DBF4 homolog B, consists of four isoforms of sizes 67.2 kDa, 47.2 kDa, 54.7 kDa, and 18.4 kDa and is involved in DNA replication and cellular generation by stimulating kinase activity. The protein has not been researched in association with any diseases. The protein interacts with PTEN, APC, CDC7, MDFI, and KRTAP4-12 proteins during the early S phase of cell cycle DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DBF4B