DAZL Antibody

Images

 
Western Blot: DAZL Antibody [NBP1-85307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human testis shows distinct positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DAZL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAZL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DAZL Protein (NBP1-85307PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DAZL Antibody

  • DAZHSPGY-like-autosomal
  • DAZL1DAZ-like autosomal
  • DAZLA
  • Deleted in azoospermia-like 1
  • deleted in azoospermia-like
  • germline specific RNA binding protein
  • MGC26406
  • spermatogenesis gene on the Y-like autosomal
  • SPGYLADAZ homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-46582
Species: Hu
Applications: WB, IHC
AF2030
Species: Hu
Applications: WB, IHC
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-387
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-29997
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27292
Species: Hu
Applications: IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for DAZL Antibody (NBP1-85307) (0)

There are no publications for DAZL Antibody (NBP1-85307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAZL Antibody (NBP1-85307) (0)

There are no reviews for DAZL Antibody (NBP1-85307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAZL Antibody (NBP1-85307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAZL Products

Bioinformatics Tool for DAZL Antibody (NBP1-85307)

Discover related pathways, diseases and genes to DAZL Antibody (NBP1-85307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAZL Antibody (NBP1-85307)

Discover more about diseases related to DAZL Antibody (NBP1-85307).
 

Pathways for DAZL Antibody (NBP1-85307)

View related products by pathway.

PTMs for DAZL Antibody (NBP1-85307)

Learn more about PTMs related to DAZL Antibody (NBP1-85307).

Blogs on DAZL

There are no specific blogs for DAZL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAZL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAZL