DAZAP1 Antibody - Azide and BSA Free

Western Blot: DAZAP1 Antibody [H00026528-B01P] - Analysis of DAZAP1 expression in transfected 293T cell line by DAZAP1 polyclonal antibody. Lane 1: DAZAP1 transfected lysate(44.77 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: DAZAP1 Antibody [H00026528-B01P] - Analysis of purified antibody to DAZAP1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DAZAP1 Antibody - Azide and BSA Free Summary

• Immunogen: DAZAP1 (NP_061832.2, 1 a.a. - 407 a.a.) full-length human protein. MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: DAZAP1
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional, Immunofluorescence

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DAZAP1 Antibody - Azide and BSA Free

• DAZ associated protein 1
• DAZ-associated protein 1
• deleted in azoospermia associated protein 1
• Deleted in azoospermia-associated protein 1
• MGC19907

Background

In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAZAP1
• Uniprot:
  • NP_061832.2(Human)