![Western Blot: DAAM2 Antibody [NBP2-92809] - Analysis of extracts of various cell lines, using DAAM2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.](http://images.novusbio.com/fullsize/DAAM2-Antibody-Western-Blot-NBP2-92809-img0002.jpg "Western Blot: DAAM2 Antibody [NBP2-92809] - Analysis of extracts of various cell lines, using DAAM2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DAAM2 Antibody - BSA Free (NBP2-92809) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2). MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAAM2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 123 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAAM2 |
![Immunocytochemistry/Immunofluorescence: DAAM2 Antibody [NBP2-92809] - Analysis of L929 cells using DAAM2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/DAAM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92809-img0004.jpg "Immunocytochemistry/Immunofluorescence: DAAM2 Antibody [NBP2-92809] - Analysis of L929 cells using DAAM2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] - Immunofluorescence analysis of U2OS cells using DAAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92809_rabbit-polyclonal-daam2-antibody-4220251429059.jpg%3Ft=1703485416 "Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] - Immunofluorescence analysis of U2OS cells using DAAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] - Immunofluorescence analysis of H9C2 cells using DAAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92809_rabbit-polyclonal-daam2-antibody-42202514264426.jpg%3Ft=1703485416 "Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] - Immunofluorescence analysis of H9C2 cells using DAAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Bioactivity Wnt-5a [Unconjugated]](https://images.novusbio.com/images/protein/645-wn_recombinant-human-mouse-wnt-5a-protein-bioactivity-1612202094911.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")