FHDC1 Antibody

Images

 
Immunohistochemistry-Paraffin: FHDC1 Antibody [NBP1-93579] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FHDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EHELVTGLAQFNLQGSQGMEETSQLTLSDFSPMELESVGHRGPQSLSASSSSLTPMGRDALGSLSPALEDGKAAPDEPGSAALGSVGSSDPENKDPRPLFCISDTTDCSLTLDCSEGTDSRPRGGDPEEGGEGDGSMSSGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FHDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FHDC1 Protein (NBP1-93579PEP)
Publications
Read Publication using NBP1-93579.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FHDC1 Antibody

  • FH2 domain containing 1
  • FH2 domain-containing protein 1
  • KIAA1727

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24724
Species: Ca, Eq, Hu, Mu, Pm, Rt, RM
Applications: WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-47496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83900
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-94174
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33431
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-80419
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC-P, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-24615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85217
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00023002-M03
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
NBP2-24748
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59474
Species: Hu
Applications: IHC, IHC-P, WB
5190-GR
Species: Hu
Applications: BA
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87933
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-14022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-88830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for FHDC1 Antibody (NBP1-93579)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-93579 Applications Species
Wang S, Wang y, Wang J et al. LncRNA LINC00665 promotes ovarian cancer cell proliferation and inhibits apoptosis via targeting miR-181a-5p/FHDC Research Square May 3 2021

Reviews for FHDC1 Antibody (NBP1-93579) (0)

There are no reviews for FHDC1 Antibody (NBP1-93579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FHDC1 Antibody (NBP1-93579) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHDC1 Products

Array NBP1-93579

Bioinformatics Tool for FHDC1 Antibody (NBP1-93579)

Discover related pathways, diseases and genes to FHDC1 Antibody (NBP1-93579). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHDC1 Antibody (NBP1-93579)

Discover more about diseases related to FHDC1 Antibody (NBP1-93579).
 

Pathways for FHDC1 Antibody (NBP1-93579)

View related products by pathway.

PTMs for FHDC1 Antibody (NBP1-93579)

Learn more about PTMs related to FHDC1 Antibody (NBP1-93579).

Blogs on FHDC1

There are no specific blogs for FHDC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FHDC1