Cytokeratin 7 Antibody

Images

 
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell line SiHa.
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell lines A-549 and HEK293 using Anti-KRT7 antibody. Corresponding KRT7 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Simple Western lane view shows a specific band for KRT7 in 0.2 mg/ml of Tonsil (left), RT-4 (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Electropherogram image(s) of corresponding Simple Western lane view. Cytokeratin 7 antibody was used at 1:50 dilution on Tonsil and RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Cytokeratin 7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:50
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Cytokeratin 7 Recombinant Protein Antigen (NBP1-88080PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytokeratin 7 Antibody

  • CK7
  • CK-7
  • cytokeratin 7
  • cytokeratin-7
  • K2C7
  • K7keratin, 55K type II cytoskeletal
  • keratin 7
  • keratin, type II cytoskeletal 7
  • keratin-7
  • MGC129731
  • MGC3625
  • sarcolectin
  • SCLkeratin, simple epithelial type I, K7
  • type II mesothelial keratin K7
  • Type-II keratin Kb7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for Cytokeratin 7 Antibody (NBP1-88080) (0)

There are no publications for Cytokeratin 7 Antibody (NBP1-88080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 7 Antibody (NBP1-88080) (0)

There are no reviews for Cytokeratin 7 Antibody (NBP1-88080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 7 Antibody (NBP1-88080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 7 Products

Bioinformatics Tool for Cytokeratin 7 Antibody (NBP1-88080)

Discover related pathways, diseases and genes to Cytokeratin 7 Antibody (NBP1-88080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 7 Antibody (NBP1-88080)

Discover more about diseases related to Cytokeratin 7 Antibody (NBP1-88080).
 

Pathways for Cytokeratin 7 Antibody (NBP1-88080)

View related products by pathway.

PTMs for Cytokeratin 7 Antibody (NBP1-88080)

Learn more about PTMs related to Cytokeratin 7 Antibody (NBP1-88080).
 

Research Areas for Cytokeratin 7 Antibody (NBP1-88080)

Find related products by research area.

Blogs on Cytokeratin 7

There are no specific blogs for Cytokeratin 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT7
Entrez
Uniprot