Cytokeratin 7 Antibody

Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining in human placenta and skeletal muscle tissues. Corresponding KRT7 RNA-seq data are presented for the same tissues.

Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell lines A-549 and HEK293 using Anti-KRT7 antibody. Corresponding KRT7 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human breast shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human lung shows moderate membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Simple Western lane view shows a specific band for KRT7 in 0.2 mg/ml of Tonsil (left), RT-4 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Electropherogram image(s) of corresponding Simple Western lane view. Cytokeratin 7 antibody was used at 1:50 dilution on Tonsil and RT-4 lysate(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cytokeratin 7 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
• Specificity: Specificity of human Cytokeratin 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:50
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control:

  Cytokeratin 7 Knockout HeLa Cell Lysate

• Control Peptide:

  Cytokeratin 7 Recombinant Protein Antigen (NBP1-88080PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cytokeratin 7 Antibody

• CK7
• CK-7
• cytokeratin 7
• cytokeratin-7
• K2C7
• K7keratin, 55K type II cytoskeletal
• keratin 7
• keratin, type II cytoskeletal 7
• keratin-7
• MGC129731
• MGC3625
• sarcolectin
• SCLkeratin, simple epithelial type I, K7
• type II mesothelial keratin K7
• Type-II keratin Kb7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytokeratin 7 Antibody (NBP1-88080)(1)

Publication using NBP1-88080

• Quach C, Song Y, Guo H, et al. A truncating mutation in the autophagy gene UVRAG drives inflammation and tumorigenesis in mice Nat Commun Dec 12 2019 [PMID: 31831743] (WB, Mouse)

Bioinformatics

• Gene Symbol: KRT7
• Entrez:
  • 3855(Human)
  • 110310(Mouse)
  • 300242(Rat)
• Uniprot:
  • P08729(Human)