Cytokeratin 6a Antibody - BSA Free

Western Blot: Cytokeratin 6a Antibody [NBP1-98557] - A549 Cell Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cytokeratin 6a Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Cytokeratin 6a - middle region. Peptide sequence RGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKAD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT6A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cytokeratin 6a Antibody - BSA Free

• Allergen Hom s 5
• CK6A
• CK-6A
• CK6C
• CK6D
• CK-6D
• cytokeratin 6A
• cytokeratin 6C
• cytokeratin 6D
• Cytokeratin-6A
• Cytokeratin-6D
• K6A
• K6C
• K6D
• keratin 6A
• keratin 6C
• keratin 6D
• keratin, epidermal type II, K6A
• keratin, type II cytoskeletal 6A
• Keratin-6A
• KRT6C
• KRT6D
• Type-II keratin Kb6

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT6A
• Uniprot:
  • NP_005545(Human)