Cytochrome P450 4F11 Antibody


Western Blot: Cytochrome P450 4F11 Antibody [NBP1-69423] - This Anti-CYP4F11 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Cytochrome P450 4F11 Antibody Summary

Synthetic peptides corresponding to CYP4F11(cytochrome P450, family 4, subfamily F, polypeptide 11) The peptide sequence was selected from the N terminal of CYP4F11. Peptide sequence FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP4F11 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytochrome P450 4F11 Antibody

  • CYPIVF11
  • cytochrome P450 4F11
  • cytochrome P450, family 4, subfamily F, polypeptide 11
  • cytochrome P450, subfamily IVF, polypeptide 11
  • EC


CYP4F11 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined.This gene, CYP4F11, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F2, is approximately 16 kb away.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl

Publications for Cytochrome P450 4F11 Antibody (NBP1-69423) (0)

There are no publications for Cytochrome P450 4F11 Antibody (NBP1-69423).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 4F11 Antibody (NBP1-69423) (0)

There are no reviews for Cytochrome P450 4F11 Antibody (NBP1-69423). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 4F11 Antibody (NBP1-69423) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytochrome P450 4F11 Products

Bioinformatics Tool for Cytochrome P450 4F11 Antibody (NBP1-69423)

Discover related pathways, diseases and genes to Cytochrome P450 4F11 Antibody (NBP1-69423). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 4F11 Antibody (NBP1-69423)

Discover more about diseases related to Cytochrome P450 4F11 Antibody (NBP1-69423).

Pathways for Cytochrome P450 4F11 Antibody (NBP1-69423)

View related products by pathway.

PTMs for Cytochrome P450 4F11 Antibody (NBP1-69423)

Learn more about PTMs related to Cytochrome P450 4F11 Antibody (NBP1-69423).

Blogs on Cytochrome P450 4F11

There are no specific blogs for Cytochrome P450 4F11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytochrome P450 4F11 Antibody and receive a gift card or discount.


Gene Symbol CYP4F11