CYP4F3 Antibody

Images

 
Western Blot: CYP4F3 Antibody [NBP1-69678] - This Anti-CYP4F3 antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.
Immunocytochemistry/ Immunofluorescence: CYP4F3 Antibody [NBP1-69678] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, moderate tissue ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP4F3 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP4F3(cytochrome P450, family 4, subfamily F, polypeptide 3) The peptide sequence was selected from the N terminal of CYP4F3. Peptide sequence LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP4F3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CYP4F3 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP4F3 Antibody

  • CYP4F
  • CYPIVF3
  • Cytochrome P450 4F3
  • cytochrome P-450
  • cytochrome P450, family 4, subfamily F, polypeptide 3
  • cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omegahydroxylase)
  • Cytochrome P450-LTB-omega
  • EC 1.14.13.30
  • leukotriene B4 omega hydroxylase
  • Leukotriene-B(4) 20-monooxygenase 2
  • leukotriene-B(4) omega-hydroxylase 2
  • leukotriene-B4 20-monooxygenase
  • LTB4HCPF3

Background

This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86461
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-46854
Species: Hu
Applications: IHC, IHC-P
NBP2-50212
Species: Hu, Mu, Rt, Dr, Xp
Applications: WB, ELISA, IHC
NBP2-16082
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-10373
Species: Hu
MAB1684
Species: Hu
Applications: WB
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CYP4F3 Antibody (NBP1-69678) (0)

There are no publications for CYP4F3 Antibody (NBP1-69678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4F3 Antibody (NBP1-69678) (0)

There are no reviews for CYP4F3 Antibody (NBP1-69678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYP4F3 Antibody (NBP1-69678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP4F3 Products

Bioinformatics Tool for CYP4F3 Antibody (NBP1-69678)

Discover related pathways, diseases and genes to CYP4F3 Antibody (NBP1-69678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4F3 Antibody (NBP1-69678)

Discover more about diseases related to CYP4F3 Antibody (NBP1-69678).
 

Pathways for CYP4F3 Antibody (NBP1-69678)

View related products by pathway.

PTMs for CYP4F3 Antibody (NBP1-69678)

Learn more about PTMs related to CYP4F3 Antibody (NBP1-69678).
 

Research Areas for CYP4F3 Antibody (NBP1-69678)

Find related products by research area.

Blogs on CYP4F3

There are no specific blogs for CYP4F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP4F3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4F3
Uniprot