CYRPTIC/CFC1 Antibody Summary
| Immunogen |
The immunogen for this antibody is CFC1 - N-terminal region. Peptide sequence IINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGW. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CFC1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CYRPTIC/CFC1 Antibody
Background
This gene encodes a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. EGF-CFC family member proteins share a variant EGF-like motif, a conserved cysteine-rich domain, and a C-terminal hydrophobic region. These proteins play key roles in intercellular signaling pathways during vertebrate embryogenesis. Mutations in this gene can cause autosomal visceral heterotaxy. This protein is involved in left-right asymmetric morphogenesis during organ development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, Block
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Ha, Mk, Rb
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC
Publications for CYRPTIC/CFC1 Antibody (NBP1-98527) (0)
There are no publications for CYRPTIC/CFC1 Antibody (NBP1-98527).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CYRPTIC/CFC1 Antibody (NBP1-98527) (0)
There are no reviews for CYRPTIC/CFC1 Antibody (NBP1-98527).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CYRPTIC/CFC1 Antibody (NBP1-98527) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional CYRPTIC/CFC1 Products
Bioinformatics Tool for CYRPTIC/CFC1 Antibody (NBP1-98527)
Discover related pathways, diseases and genes to CYRPTIC/CFC1 Antibody (NBP1-98527). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CYRPTIC/CFC1 Antibody (NBP1-98527)
Discover more about diseases related to CYRPTIC/CFC1 Antibody (NBP1-98527).
| | Pathways for CYRPTIC/CFC1 Antibody (NBP1-98527)
View related products by pathway.
|
PTMs for CYRPTIC/CFC1 Antibody (NBP1-98527)
Learn more about PTMs related to CYRPTIC/CFC1 Antibody (NBP1-98527).
|
Blogs on CYRPTIC/CFC1
![Western Blot: CFC1 Antibody [NBP1-98527] - Hela Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%](http://images.novusbio.com/fullsize2/CFC1-Antibody-Western-Blot-NBP1-98527-img0002.jpg "Western Blot: CFC1 Antibody [NBP1-98527] - Hela Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%")
![Western Blot: CRIPTO Antibody [NB100-1598] - Total protein from human HeLa, NTERA-2 and spleen and embryonic mouse V6.5 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Cripto in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/fullsize2/CRIPTO-Antibody-Western-Blot-NB100-1598-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: CRIPTO Antibody [NB100-1598] - CRIPTO antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).](http://images.novusbio.com/fullsize2/CRIPTO-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1598-img0010.jpg)
![Flow Cytometry: CRIPTO Antibody [NB100-1598] - An intracellular stain was performed on Jurkat with CRIPTO Antibody NB100-1598 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (SA5-10033, Thermo Fisher).](http://images.novusbio.com/fullsize2/CRIPTO-Antibody-Flow-Cytometry-NB100-1598-img0012.jpg)
![Nodal [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Nodal [Unconjugated]")
![Western Blot: NKX2.5 Antibody [NBP1-31558] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Nkx2.5 antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/NKX2.5-Antibody-Western-Blot-NBP1-31558-img0021.jpg)
![Immunocytochemistry/Immunofluorescence: NKX2.5 Antibody [NBP1-31558] - Paraformaldehyde-fixed mouse ESC D3, using antibody at 1:200 dilution.](http://images.novusbio.com/fullsize2/NKX2.5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31558-img0015.jpg)
![Immunohistochemistry-Paraffin: NKX2.5 Antibody [NBP1-31558] - Rat heart. Nkx2.5 stained by Nkx2.5 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.](http://images.novusbio.com/fullsize2/NKX2.5-Antibody-Immunohistochemistry-Paraffin-NBP1-31558-img0022.jpg)
![Immunocytochemistry/Immunofluorescence: PITX2 Antibody (2G6) [H00005308-M01] - Analysis of monoclonal antibody to PITX2 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/PITX2-Antibody-(2G6)-Immunocytochemistry-Immunofluorescence-H00005308-M01-img0003.jpg)
![ELISA: PITX2 Antibody (2G6) [H00005308-M01] - Detection limit for recombinant GST tagged PITX2 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/PITX2-Antibody-(2G6)-ELISA-H00005308-M01-img0005.jpg)
![Western Blot: SMOX Antibody [NBP2-55775] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/SMOX Antibody-Western Blot-NBP2-55775-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/SMOX-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55775-img0001.jpg)
![Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.](http://images.novusbio.com/fullsize2/OCT4-Antibody-Western-Blot-NB100-2379-img0011.jpg)
![Western Blot: OCT4 Antibody [NB100-2379] - The expression of pluripotency factors Oct4 in human head and neck cancer cell lines.](http://images.novusbio.com/fullsize2/OCT4-Antibody-Western-Blot-NB100-2379-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: OCT4 Antibody [NB100-2379] - OCT4 staining in NTERA-2 cells detected with a Dylight 488 labeled secondary antibody.](http://images.novusbio.com/fullsize2/OCT4 Antibody-Immunocytochemistry-Immunofluorescence-NB100-2379-img0008.jpg)
![Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.](http://images.novusbio.com/fullsize2/POMC-Antibody-Western-Blot-NB100-1533-img0005.jpg)
![Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.](http://images.novusbio.com/fullsize2/POMC-Antibody-Immunohistochemistry-Paraffin-NB100-1533-img0003.jpg)
![Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/fullsize2/POMC-Antibody-Flow-Cytometry-NB100-1533-img0006.jpg)
![Immunohistochemistry-Paraffin: Smoothened Antibody [NLS2666] - Analysis of anti-Smoothened antibody with human kidney.](http://images.novusbio.com/fullsize2/Smoothened Antibody-Immunohistochemistry-Paraffin-NLS2666-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")