![Western Blot: CYPIVF8 Antibody [H00011283-B01P-50ug] - Analysis of CYP4F8 expression in transfected 293T cell line (H00011283-T01) by CYP4F8 MaxPab polyclonal antibody. Lane 1: CYP4F8 transfected lysate(57.2 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CYPIVF8-Antibody-Western-Blot-H00011283-B01P-50ug-img0001.jpg "Western Blot: CYPIVF8 Antibody [H00011283-B01P-50ug] - Analysis of CYP4F8 expression in transfected 293T cell line (H00011283-T01) by CYP4F8 MaxPab polyclonal antibody. Lane 1: CYP4F8 transfected lysate(57.2 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | CYP4F8 (AAI56577.1, 1 a.a. - 520 a.a.) full-length human protein. MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CYP4F8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CYPIVF8 Antibody (H00011283-B01P-50ug)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYP4F8 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB](https://images.novusbio.com/images/Goat-anti-Mouse-IgG-H+L-Secondary-Antibody-HRP-Immunohistochemistry-Paraffin-NB7539-img0014.jpg "Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")