CYP4B1 Antibody

Images

 
Western Blot: CYP4B1 Antibody [NBP1-69677] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: CYP4B1 Antibody [NBP1-69677] - This Anti-CYP4B1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.
Western Blot: CYP4B1 Antibody [NBP1-69677] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP4B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP4B1(cytochrome P450, family 4, subfamily B, polypeptide 1) The peptide sequence was selected from the N terminal of CYP4B1. Peptide sequence SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP4B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP4B1 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP4B1 Antibody

  • CYPIVB1
  • cytochrome P450 4B1
  • cytochrome P450, family 4, subfamily B, polypeptide 1
  • cytochrome P450, subfamily IVB, polypeptide 1
  • Cytochrome P450-HP
  • EC 1.14.14.1
  • microsomal monooxygenase
  • P-450HP

Background

CYP4B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined. Two transcript variants encoding slightly different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001551-B01P
Species: Hu
Applications: WB
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14922
Species: Hu
Applications: WB
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33467
Species: Hu
Applications: IHC, IHC-P

Publications for CYP4B1 Antibody (NBP1-69677) (0)

There are no publications for CYP4B1 Antibody (NBP1-69677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4B1 Antibody (NBP1-69677) (0)

There are no reviews for CYP4B1 Antibody (NBP1-69677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4B1 Antibody (NBP1-69677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP4B1 Products

Bioinformatics Tool for CYP4B1 Antibody (NBP1-69677)

Discover related pathways, diseases and genes to CYP4B1 Antibody (NBP1-69677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4B1 Antibody (NBP1-69677)

Discover more about diseases related to CYP4B1 Antibody (NBP1-69677).
 

Pathways for CYP4B1 Antibody (NBP1-69677)

View related products by pathway.

PTMs for CYP4B1 Antibody (NBP1-69677)

Learn more about PTMs related to CYP4B1 Antibody (NBP1-69677).

Blogs on CYP4B1

There are no specific blogs for CYP4B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP4B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4B1
Uniprot