Recombinant Human CYP11A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CYP11A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human CYP11A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
CYP11A1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP11A1 Protein

  • Cholesterol desmolase
  • cholesterol monooxygenase (side-chain-cleaving)
  • cholesterol side-chain cleavage enzyme, mitochondrial
  • CYPXIA1
  • Cytochrome P450 11A1
  • Cytochrome P450(scc)
  • cytochrome P450, family 11, subfamily A, polypeptide 1
  • cytochrome P450C11A1
  • EC 1.14.15
  • EC 1.14.15.6
  • steroid 20-22-lyase
  • subfamily XIA (cholesterol side chain cleavage)

Background

CYP11A1 - cytochrome P450, family 11, subfamily A, polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56518
Species: Hu
Applications: WB
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001583-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CYP11A1 Partial Recombinant Protein (H00001583-Q01) (0)

There are no publications for CYP11A1 Partial Recombinant Protein (H00001583-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11A1 Partial Recombinant Protein (H00001583-Q01) (0)

There are no reviews for CYP11A1 Partial Recombinant Protein (H00001583-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP11A1 Partial Recombinant Protein (H00001583-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP11A1 Products

Bioinformatics Tool for CYP11A1 Partial Recombinant Protein (H00001583-Q01)

Discover related pathways, diseases and genes to CYP11A1 Partial Recombinant Protein (H00001583-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11A1 Partial Recombinant Protein (H00001583-Q01)

Discover more about diseases related to CYP11A1 Partial Recombinant Protein (H00001583-Q01).
 

Pathways for CYP11A1 Partial Recombinant Protein (H00001583-Q01)

View related products by pathway.

PTMs for CYP11A1 Partial Recombinant Protein (H00001583-Q01)

Learn more about PTMs related to CYP11A1 Partial Recombinant Protein (H00001583-Q01).

Blogs on CYP11A1

There are no specific blogs for CYP11A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CYP11A1 Antibody
NBP1-54758

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYP11A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP11A1