Cylicin 1 Antibody [Unconjugated] - BSA Free

Staining of human testis shows strong cytoplasmic positivity in spermatids.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cylicin 1 Antibody [Unconjugated] - BSA Free Summary

• Description: Novus Biologicals Rabbit Cylicin 1 Antibody [Unconjugated] - BSA Free (NBP3-43686) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAKKKIDESDGTSANSKMEGLESKRGFRMSSKKTTFNEKGEKASTGRVPPSREKPPLPACEPSLPSPKVRRLCWCKMPPPPPKPRYAP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYLC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cylicin 1 Antibody [Unconjugated] - BSA Free

• CYCL1
• CYL
• CYL1
• cylicin 1
• cylicin I
• cylicin, basic protein of sperm head cytoskeleton 1
• cylicin-1
• multiple-band polypeptide I

Background

Possible architectural role during spermatogenesis. May be involved in spermatid differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYLC1