Cylicin 1 Antibody

Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining in human testis and endometrium tissues using anti-CYLC1 antibody. Corresponding CYLC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cylicin 1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYLC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cylicin 1 Recombinant Protein Antigen (NBP2-56428PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cylicin 1 Antibody

• CYCL1
• CYL
• CYL1
• cylicin 1
• cylicin I
• cylicin, basic protein of sperm head cytoskeleton 1
• cylicin-1
• multiple-band polypeptide I

Background

Possible architectural role during spermatogenesis. May be involved in spermatid differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYLC1