Cylicin 1 Antibody


Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining in human testis and endometrium tissues using anti-CYLC1 antibody. Corresponding CYLC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Cylicin 1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP
Specificity of human Cylicin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cylicin 1 Recombinant Protein Antigen (NBP2-56428PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Cylicin 1 Antibody

  • CYCL1
  • CYL
  • CYL1
  • cylicin 1
  • cylicin I
  • cylicin, basic protein of sperm head cytoskeleton 1
  • cylicin-1
  • multiple-band polypeptide I


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Flow, IHC, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Cylicin 1 Antibody (NBP2-56428) (0)

There are no publications for Cylicin 1 Antibody (NBP2-56428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cylicin 1 Antibody (NBP2-56428) (0)

There are no reviews for Cylicin 1 Antibody (NBP2-56428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cylicin 1 Antibody (NBP2-56428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Cylicin 1 Antibody (NBP2-56428)

Discover related pathways, diseases and genes to Cylicin 1 Antibody (NBP2-56428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cylicin 1 Antibody (NBP2-56428)

Discover more about diseases related to Cylicin 1 Antibody (NBP2-56428).

Blogs on Cylicin 1

There are no specific blogs for Cylicin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cylicin 1 Antibody and receive a gift card or discount.


Gene Symbol CYLC1