CXXC5 Antibody

Images

 
Western Blot: CXXC5 Antibody [NBP2-87233] - Host: Rabbit. Target Name: Cxxc5. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Mu, Hu, Rt, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXXC5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse CXXC5. Peptide sequence: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
CXXC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXXC5 Antibody

  • CF5
  • CXXC finger 5 protein
  • CXXC finger 5
  • CXXC finger protein 5
  • CXXC-type zinc finger protein 5
  • HSPC195
  • Putative MAPK-activating protein PM08
  • Putative NF-kappa-B-activating protein 102
  • retinoid-inducible nuclear factor
  • RINF
  • WID
  • WT1-induced Inhibitor of Dishevelled

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76491
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB110-60011
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Single-Cell Western
H00171023-M05
Species: Hu
Applications: WB, ELISA, IP
NB100-1268
Species: Hu, Mu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, KD, KO
AF6347
Species: Hu
Applications: WB
NBP2-22408
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-75671
Species: Hu
Applications: WB, ICC/IF, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF8107
Species: Hu
Applications: WB, IHC
H00000537-M01
Species: Hu, Rt
Applications: WB, ELISA, S-ELISA
AF3287
Species: Hu, Mu, Rt
Applications: WB

Publications for CXXC5 Antibody (NBP2-87233) (0)

There are no publications for CXXC5 Antibody (NBP2-87233).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXXC5 Antibody (NBP2-87233) (0)

There are no reviews for CXXC5 Antibody (NBP2-87233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXXC5 Antibody (NBP2-87233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CXXC5 Products

Bioinformatics Tool for CXXC5 Antibody (NBP2-87233)

Discover related pathways, diseases and genes to CXXC5 Antibody (NBP2-87233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXXC5 Antibody (NBP2-87233)

Discover more about diseases related to CXXC5 Antibody (NBP2-87233).
 

Pathways for CXXC5 Antibody (NBP2-87233)

View related products by pathway.

PTMs for CXXC5 Antibody (NBP2-87233)

Learn more about PTMs related to CXXC5 Antibody (NBP2-87233).
 

Research Areas for CXXC5 Antibody (NBP2-87233)

Find related products by research area.

Blogs on CXXC5

There are no specific blogs for CXXC5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXXC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXXC5