ATP6AP1 Antibody (3A2)

Images

 
Western Blot: ATP6AP1 Antibody (3A2) [H00000537-M01] - Analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M01), clone 3A2.Lane 1: ATP6AP1 transfected lysate(52 KDa).Lane 2: ...read more
Western Blot: ATP6AP1 Antibody (3A2) [H00000537-M01] - ATP6AP1 monoclonal antibody (M01), clone 3A2 Analysis of ATP6AP1 expression in HeLa.
Western Blot: ATP6AP1 Antibody (3A2) [H00000537-M01] - ATP6AP1 monoclonal antibody (M01), clone 3A2. Analysis of ATP6AP1 expression in PC-12.
Sandwich ELISA: ATP6AP1 Antibody (3A2) [H00000537-M01] - Detection limit for recombinant GST tagged ATP6AP1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP6AP1 Antibody (3A2) Summary

Immunogen
ATP6AP1 (NP_001174, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE
Specificity
ATP6AP1 - ATPase, H+ transporting, lysosomal accessory protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP6AP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00000537-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6AP1 Antibody (3A2)

  • 16A
  • Ac45
  • ATP6IP1V-ATPase subunit S1
  • ATP6S1ORF
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump), subunit 1
  • ATPase, H+ transporting, lysosomal accessory protein 1
  • H+ transporting, lysosomal interacting protein 1
  • H-ATPase subunit
  • MGC129781
  • Protein XAP-3
  • Vacuolar proton pump subunit S1
  • VATPS1V-ATPase Ac45 subunit
  • V-type proton ATPase subunit S1
  • XAP-3
  • XAP3V-ATPase S1 accessory protein

Background

This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-90820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87581
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-73857
Species: Hu, Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF4779
Species: Hu
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
H00000537-M01
Species: Hu, Rt
Applications: WB, ELISA, S-ELISA

Publications for ATP6AP1 Antibody (H00000537-M01)(2)

Reviews for ATP6AP1 Antibody (H00000537-M01) (0)

There are no reviews for ATP6AP1 Antibody (H00000537-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6AP1 Antibody (H00000537-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP6AP1 Products

Bioinformatics Tool for ATP6AP1 Antibody (H00000537-M01)

Discover related pathways, diseases and genes to ATP6AP1 Antibody (H00000537-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6AP1 Antibody (H00000537-M01)

Discover more about diseases related to ATP6AP1 Antibody (H00000537-M01).
 

Pathways for ATP6AP1 Antibody (H00000537-M01)

View related products by pathway.

PTMs for ATP6AP1 Antibody (H00000537-M01)

Learn more about PTMs related to ATP6AP1 Antibody (H00000537-M01).

Blogs on ATP6AP1

There are no specific blogs for ATP6AP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6AP1 Antibody (3A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6AP1
Entrez
OMIM
Uniprot