| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC, Mycoplasma |
| Clone | 3B9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | PPBP (AAH28217, 37 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
| Specificity | PPBP - pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PPBP |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. IHC-Fr usage reported in scientific literature (PMID: 25858640). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00005473-M01 | Applications | Species |
|---|---|---|
| Yeo L, Adlard N, Biehl M et al. Expression of chemokines CXCL4 and CXCL7 by synovial macrophages defines an early stage of rheumatoid arthritis Ann. Rheum. Dis. 2015-04-09 [PMID: 25858640] (IHC-Fr, Human) | IHC-Fr | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CXCL7/NAP-2 Antibody (H00005473-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.