CXCL4/PF4 Antibody

Images

 
Western Blot: CXCL4/PF4 Antibody [H00005196-D01P] - Analysis of PF4 expression in human spleen.
Western Blot: CXCL4/PF4 Antibody [H00005196-D01P] - Analysis of PF4 expression in A-431.
Western Blot: CXCL4/PF4 Antibody [H00005196-D01P] - Analysis of PF4 expression in transfected 293T cell line by PF4 polyclonal antibody.Lane 1: PF4 transfected lysate(10.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXCL4/PF4 Antibody Summary

Immunogen
PF4 (NP_002610.1, 1 a.a. - 101 a.a.) full-length human protein. MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Specificity
PF4 - platelet factor 4 (chemokine (C-X-C motif) ligand 4),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PF4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL4/PF4 Antibody

  • chemokine (C-X-C motif) ligand 4
  • C-X-C motif chemokine 4
  • CXCL4
  • CXCL4iroplact
  • Iroplact
  • MGC138298
  • Oncostatin-A
  • PF4
  • PF-4
  • platelet factor 4
  • SCYB4oncostatin-A

Background

Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1267
Species: Hu
Applications: WB, IP, Neut
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NB600-930
Species: Hu, Ba
Applications: WB, ELISA

Publications for CXCL4/PF4 Antibody (H00005196-D01P) (0)

There are no publications for CXCL4/PF4 Antibody (H00005196-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL4/PF4 Antibody (H00005196-D01P) (0)

There are no reviews for CXCL4/PF4 Antibody (H00005196-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCL4/PF4 Antibody (H00005196-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL4/PF4 Products

Bioinformatics Tool for CXCL4/PF4 Antibody (H00005196-D01P)

Discover related pathways, diseases and genes to CXCL4/PF4 Antibody (H00005196-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL4/PF4 Antibody (H00005196-D01P)

Discover more about diseases related to CXCL4/PF4 Antibody (H00005196-D01P).
 

Pathways for CXCL4/PF4 Antibody (H00005196-D01P)

View related products by pathway.

PTMs for CXCL4/PF4 Antibody (H00005196-D01P)

Learn more about PTMs related to CXCL4/PF4 Antibody (H00005196-D01P).
 

Research Areas for CXCL4/PF4 Antibody (H00005196-D01P)

Find related products by research area.

Blogs on CXCL4/PF4

There are no specific blogs for CXCL4/PF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL4/PF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PF4
Entrez
Uniprot