CXCL4/PF4 Antibody (3F6)

Western Blot: CXCL4/PF4 Antibody (3F6) [H00005196-M01] - Analysis of PF4 expression in transfected 293T cell line by PF4 monoclonal antibody (M01), clone 3F6.Lane 1: PF4 transfected lysate(10.8 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: CXCL4/PF4 Antibody (3F6) [H00005196-M01] - Analysis of PF4 transfected lysate using anti-PF4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PF4 MaxPab rabbit polyclonal antibody.

Sandwich ELISA: CXCL4/PF4 Antibody (3F6) [H00005196-M01] - Detection limit for recombinant GST tagged PF4 is approximately 1ng/ml as a capture antibody.

Product Discontinued

CXCL4/PF4 Antibody (3F6) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PF4 (NP_002610, 31 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
• Specificity: PF4 - platelet factor 4 (chemokine (C-X-C motif) ligand 4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PF4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL4/PF4 Antibody (3F6)

• chemokine (C-X-C motif) ligand 4
• C-X-C motif chemokine 4
• CXCL4
• CXCL4iroplact
• Iroplact
• MGC138298
• Oncostatin-A
• PF4
• PF-4
• platelet factor 4
• SCYB4oncostatin-A

Background

Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PF4
• Entrez:
  • 5196(Human)
• OMIM:
  • 173460(Human)
• Uniprot:
  • NP_002610(Human)