CXADR Antibody

Images

 
Western Blot: CXADR Antibody [NBP1-88194] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88194] - Staining of human prostate shows distinct membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXADR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXADR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXADR Protein (NBP1-88194PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXADR Antibody

  • CAR10Coxsackievirus B-adenovirus receptor
  • CAR4/6
  • coxsackie virus and adenovirus receptor
  • coxsackie virus B receptor
  • coxsackievirus and adenovirus receptor
  • CVB3 binding protein
  • CVB3 BP
  • CVB3-binding protein
  • CXADR
  • HCAR
  • HCVADR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
AF7356
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
AF2009
Species: Hu
Applications: WB, IHC
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC

Publications for CXADR Antibody (NBP1-88194) (0)

There are no publications for CXADR Antibody (NBP1-88194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXADR Antibody (NBP1-88194) (0)

There are no reviews for CXADR Antibody (NBP1-88194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXADR Antibody (NBP1-88194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXADR Products

Bioinformatics Tool for CXADR Antibody (NBP1-88194)

Discover related pathways, diseases and genes to CXADR Antibody (NBP1-88194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXADR Antibody (NBP1-88194)

Discover more about diseases related to CXADR Antibody (NBP1-88194).
 

Pathways for CXADR Antibody (NBP1-88194)

View related products by pathway.

Research Areas for CXADR Antibody (NBP1-88194)

Find related products by research area.

Blogs on CXADR

There are no specific blogs for CXADR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXADR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXADR
Entrez