We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CX3CL1/Fractalkine Recombinant Protein Antigen

Images

 
There are currently no images for CX3CL1/Fractalkine Protein (NBP1-89309PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CX3CL1/Fractalkine Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CX3CL1.

Source: E. coli

Amino Acid Sequence: GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CX3CL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89309.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CX3CL1/Fractalkine Recombinant Protein Antigen

  • ABCD-3
  • C3Xkine
  • chemokine (C-X3-C motif) ligand 1
  • CX3C membrane-anchored chemokine
  • CX3CL1
  • CXC3
  • CXC3C
  • FKN
  • Fractalkine
  • Neurotactin
  • neurotactin)
  • NTNsmall inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine
  • NTTSmall-inducible cytokine D1
  • SCYD1C-X3-C motif chemokine 1
  • small inducible cytokine subfamily D (Cys-X3-Cys), member-1

Background

CX3CL1, also known as fractalkine, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, neurotactin, small-inducible cytokine D1, FKN, NTT, and SCYD1, is a member of the intercrine delta family. The soluble form of CX3CL1 is chemotactic for monocytes and T-cells, but not for neutrophils. CX3CL1's membrane bound form promotes adhesion of the monocytes and T-cells to endothelial cells. Additionally, CX3CL1 binds to CX3CR1 and regulates adhesion and migration of leukocyte processes at the endothelium.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76949
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P
DCP00
Species: Hu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
1297-NE
Species: Hu
Applications: Bind, BA
212-GD
Species: Hu
Applications: Bind, BA
M6000B
Species: Mu
Applications: ELISA
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
DIP100
Species: Hu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
350-NS
Species: Fe, Hu, RM
Applications: BA
DMD00
Species: Hu
Applications: ELISA
MCC170
Species: Mu
Applications: ELISA
AF482
Species: Mu
Applications: IHC, WB
DY417
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA

Publications for CX3CL1/Fractalkine Protein (NBP1-89309PEP) (0)

There are no publications for CX3CL1/Fractalkine Protein (NBP1-89309PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CX3CL1/Fractalkine Protein (NBP1-89309PEP) (0)

There are no reviews for CX3CL1/Fractalkine Protein (NBP1-89309PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CX3CL1/Fractalkine Protein (NBP1-89309PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CX3CL1/Fractalkine Products

Research Areas for CX3CL1/Fractalkine Protein (NBP1-89309PEP)

Find related products by research area.

Blogs on CX3CL1/Fractalkine

There are no specific blogs for CX3CL1/Fractalkine, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CX3CL1/Fractalkine Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CX3CL1