CWC22 Antibody

Images

 
Western Blot: CWC22 Antibody [NBP1-69211] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CWC22 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA1604 (CWC22 spliceosome-associated protein homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of KIAA1604. Peptide sequence RSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CWC22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIAA1604 and was validated on Western blot.
Theoretical MW
105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CWC22 Antibody

  • CWC22 spliceosome-associated protein homolog (S. cerevisiae)
  • EIF4GL
  • fSAPbpre-mRNA-splicing factor CWC22 homolog
  • KIAA1604NCMfunctional spliceosome-associated protein b
  • Nucampholin homolog

Background

KIAA1604 may be involved in pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-85268
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for CWC22 Antibody (NBP1-69211) (0)

There are no publications for CWC22 Antibody (NBP1-69211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CWC22 Antibody (NBP1-69211) (0)

There are no reviews for CWC22 Antibody (NBP1-69211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CWC22 Antibody (NBP1-69211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CWC22 Products

Bioinformatics Tool for CWC22 Antibody (NBP1-69211)

Discover related pathways, diseases and genes to CWC22 Antibody (NBP1-69211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CWC22 Antibody (NBP1-69211)

Discover more about diseases related to CWC22 Antibody (NBP1-69211).
 

Pathways for CWC22 Antibody (NBP1-69211)

View related products by pathway.

Blogs on CWC22

There are no specific blogs for CWC22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CWC22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CWC22
Uniprot