CTTNBP2NL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CTTNBP2NL Antibody [NBP1-84171] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & cytosol.
Immunohistochemistry-Paraffin: CTTNBP2NL Antibody [NBP1-84171] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTTNBP2NL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVILDLEEERQRHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSSMLVLECKKATNKAAEEGQKAGELSLKLEKEKSRVSKLEEELAAERKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTTNBP2NL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CTTNBP2NL Protein (NBP1-84171PEP)
Publications
Read Publication using NBP1-84171.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTTNBP2NL Antibody

  • CTTNBP2 N-terminal like
  • CTTNBP2 N-terminal-like protein
  • DKFZp547A023
  • FLJ13278
  • KIAA1433

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-74571
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-32030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55046
Species: Hu
Applications: WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-83450
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24477
Species: Hu, Pm
Applications: WB, IHC-P
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-56759
Species: Hu
Applications: ICC/IF
H00058158-B02P
Species: Hu
Applications: WB, ELISA
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84171
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CTTNBP2NL Antibody (NBP1-84171)(1)

Reviews for CTTNBP2NL Antibody (NBP1-84171) (0)

There are no reviews for CTTNBP2NL Antibody (NBP1-84171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CTTNBP2NL Antibody (NBP1-84171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTTNBP2NL Products

Bioinformatics Tool for CTTNBP2NL Antibody (NBP1-84171)

Discover related pathways, diseases and genes to CTTNBP2NL Antibody (NBP1-84171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTTNBP2NL Antibody (NBP1-84171)

Discover more about diseases related to CTTNBP2NL Antibody (NBP1-84171).

Blogs on CTTNBP2NL

There are no specific blogs for CTTNBP2NL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTTNBP2NL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTTNBP2NL