CTRB1 Antibody

Images

 
Western Blot: CTRB1 Antibody [NBP1-69669] - This Anti-CTRB1 antibody was used in Western Blot of COLO205 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTRB1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CTRB1 (chymotrypsinogen B1) The peptide sequence was selected from the middle region of CTRB1)(50ug). Peptide sequence VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTRB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CTRB1 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CTRB1 Antibody

  • chymotrypsinogen B
  • chymotrypsinogen B1
  • CTRB
  • EC 3.4.21
  • EC 3.4.21.1
  • FLJ42412
  • MGC88037

Background

Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4409
Species: Mu
Applications: WB
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
MAB3586
Species: Hu
Applications: WB, IP
AF3848
Species: Hu
Applications: WB, IHC, IP
AF1118
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00010136-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
H00001990-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA

Publications for CTRB1 Antibody (NBP1-69669) (0)

There are no publications for CTRB1 Antibody (NBP1-69669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTRB1 Antibody (NBP1-69669) (0)

There are no reviews for CTRB1 Antibody (NBP1-69669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTRB1 Antibody (NBP1-69669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTRB1 Products

Bioinformatics Tool for CTRB1 Antibody (NBP1-69669)

Discover related pathways, diseases and genes to CTRB1 Antibody (NBP1-69669). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTRB1 Antibody (NBP1-69669)

Discover more about diseases related to CTRB1 Antibody (NBP1-69669).
 

Pathways for CTRB1 Antibody (NBP1-69669)

View related products by pathway.

PTMs for CTRB1 Antibody (NBP1-69669)

Learn more about PTMs related to CTRB1 Antibody (NBP1-69669).

Blogs on CTRB1

There are no specific blogs for CTRB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTRB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTRB1
Uniprot